Lineage for d6ui1d_ (6ui1 D:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) Protein automated matches [190119] (24 species)
not a true protein
Species Vicugna pacos [TaxId:30538] [189756] (82 PDB entries) 
Domain d6ui1d_: 6ui1 D: [381949]
Other proteins in same PDB: d6ui1c_
automated match to d1mqkh_
Details for d6ui1d_
PDB Entry: 6ui1 (more details), 2.2 Å
PDB Description: crystal structure of bont/a-lchn domain in complex with vhh cia-d12, cia-b5, and cia-h7
PDB Compounds: (D:) ciA-B5SCOPe Domain Sequences for d6ui1d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ui1d_ b.1.1.1 (D:) automated matches {Vicugna pacos [TaxId: 30538]}
qlvesggglvhpggslrlscapsaslpstpfnpfnnmvgwyrqapgkqremvasiglrin
yadsvkgrftisrdnakntvdlqmdslrpedsatyychieythywgkgtlvtvssepk
SCOPe Domain Coordinates for d6ui1d_:
Click to download the PDB-style file with coordinates for d6ui1d_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d6ui1d_:
- d6ui1d_ first appeared in SCOPe 2.07
View in 3D
