Lineage for d1d5zb2 (1d5z B:1-92)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 501112Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 501113Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 501114Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 501462Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 501509Species Human (Homo sapiens), HLA-DR4 [TaxId:9606] [88824] (5 PDB entries)
  8. 501511Domain d1d5zb2: 1d5z B:1-92 [38194]
    Other proteins in same PDB: d1d5za1, d1d5za2, d1d5zb1, d1d5zc1, d1d5zc2

Details for d1d5zb2

PDB Entry: 1d5z (more details), 2 Å

PDB Description: x-ray crystal structure of hla-dr4 complexed with peptidomimetic and seb

SCOP Domain Sequences for d1d5zb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d5zb2 d.19.1.1 (B:1-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR4}
gdtrprfleqvkhechffngtervrfldryfyhqeeyvrfdsdvgeyravtelgrpdaey
wnsqkdlleqkraavdtycrhnygvgesftvq

SCOP Domain Coordinates for d1d5zb2:

Click to download the PDB-style file with coordinates for d1d5zb2.
(The format of our PDB-style files is described here.)

Timeline for d1d5zb2: