Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins) |
Protein Class II MHC alpha chain, N-terminal domain [88806] (13 species) |
Species Human (Homo sapiens), HLA-DR4 [TaxId:9606] [88811] (5 PDB entries) |
Domain d1d5za2: 1d5z A:3-81 [38193] Other proteins in same PDB: d1d5za1, d1d5zb1, d1d5zb2, d1d5zc1, d1d5zc2 complexed with ace, oda |
PDB Entry: 1d5z (more details), 2 Å
SCOP Domain Sequences for d1d5za2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d5za2 d.19.1.1 (A:3-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR4} eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan iavdkanleimtkrsnytp
Timeline for d1d5za2:
View in 3D Domains from other chains: (mouse over for more information) d1d5zb1, d1d5zb2, d1d5zc1, d1d5zc2 |