Lineage for d1d5za2 (1d5z A:3-81)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 190293Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 190294Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 190295Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins)
  6. 190467Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (12 species)
  7. 190517Species Human (Homo sapiens), HLA-DR4 [TaxId:9606] [54463] (5 PDB entries)
  8. 190518Domain d1d5za2: 1d5z A:3-81 [38193]
    Other proteins in same PDB: d1d5za1, d1d5zb1, d1d5zc1, d1d5zc2

Details for d1d5za2

PDB Entry: 1d5z (more details), 2 Å

PDB Description: x-ray crystal structure of hla-dr4 complexed with peptidomimetic and seb

SCOP Domain Sequences for d1d5za2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d5za2 d.19.1.1 (A:3-81) MHC class II, N-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR4}
eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan
iavdkanleimtkrsnytp

SCOP Domain Coordinates for d1d5za2:

Click to download the PDB-style file with coordinates for d1d5za2.
(The format of our PDB-style files is described here.)

Timeline for d1d5za2: