Lineage for d1d5za2 (1d5z A:3-81)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2938226Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 2938289Species Human (Homo sapiens), HLA-DR4 [TaxId:9606] [88811] (5 PDB entries)
  8. 2938290Domain d1d5za2: 1d5z A:3-81 [38193]
    Other proteins in same PDB: d1d5za1, d1d5zb1, d1d5zb2, d1d5zc1, d1d5zc2
    fragment; missing more than one-third of the common structure and/or sequence

Details for d1d5za2

PDB Entry: 1d5z (more details), 2 Å

PDB Description: x-ray crystal structure of hla-dr4 complexed with peptidomimetic and seb
PDB Compounds: (A:) protein (hla class II histocompatibility antigen)

SCOPe Domain Sequences for d1d5za2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d5za2 d.19.1.1 (A:3-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR4 [TaxId: 9606]}
eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan
iavdkanleimtkrsnytp

SCOPe Domain Coordinates for d1d5za2:

Click to download the PDB-style file with coordinates for d1d5za2.
(The format of our PDB-style files is described here.)

Timeline for d1d5za2: