Lineage for d1d5ma2 (1d5m A:4-81)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1020838Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1020839Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1020840Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1021292Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 1021339Species Human (Homo sapiens), HLA-DR4 [TaxId:9606] [88811] (5 PDB entries)
  8. 1021341Domain d1d5ma2: 1d5m A:4-81 [38191]
    Other proteins in same PDB: d1d5ma1, d1d5mb1, d1d5mb2, d1d5mc1, d1d5mc2
    complexed with nag

Details for d1d5ma2

PDB Entry: 1d5m (more details), 2 Å

PDB Description: x-ray crystal structure of hla-dr4 complexed with peptide and seb
PDB Compounds: (A:) hla class II histocompatibility antigen

SCOPe Domain Sequences for d1d5ma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d5ma2 d.19.1.1 (A:4-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR4 [TaxId: 9606]}
ehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalani
avdkanleimtkrsnytp

SCOPe Domain Coordinates for d1d5ma2:

Click to download the PDB-style file with coordinates for d1d5ma2.
(The format of our PDB-style files is described here.)

Timeline for d1d5ma2: