Lineage for d1hqrb2 (1hqr B:202-292)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 501112Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 501113Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 501114Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 501462Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 501493Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [88822] (10 PDB entries)
  8. 501506Domain d1hqrb2: 1hqr B:202-292 [38188]
    Other proteins in same PDB: d1hqra1, d1hqra2, d1hqrb1, d1hqrd1, d1hqrd2

Details for d1hqrb2

PDB Entry: 1hqr (more details), 3.2 Å

PDB Description: crystal structure of a superantigen bound to the high-affinity, zinc-dependent site on mhc class ii
PDB Compounds: (B:)

SCOP Domain Sequences for d1hqrb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hqrb2 d.19.1.1 (B:202-292) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR2}
dtrprflqqdkyechffngtervrflhrdiynqeedlrfdsdvgeyravtelgrpdaeyw
nsqkdfledrraavdtycrhnygvgesftvq

SCOP Domain Coordinates for d1hqrb2:

Click to download the PDB-style file with coordinates for d1hqrb2.
(The format of our PDB-style files is described here.)

Timeline for d1hqrb2: