Lineage for d1hqrb2 (1hqr B:202-292)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 190293Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 190294Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 190295Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins)
  6. 190467Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (12 species)
  7. 190503Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [54461] (3 PDB entries)
  8. 190513Domain d1hqrb2: 1hqr B:202-292 [38188]
    Other proteins in same PDB: d1hqra1, d1hqrb1, d1hqrd1, d1hqrd2

Details for d1hqrb2

PDB Entry: 1hqr (more details), 3.2 Å

PDB Description: crystal structure of a superantigen bound to the high-affinity, zinc-dependent site on mhc class ii

SCOP Domain Sequences for d1hqrb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hqrb2 d.19.1.1 (B:202-292) MHC class II, N-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR2}
dtrprflqqdkyechffngtervrflhrdiynqeedlrfdsdvgeyravtelgrpdaeyw
nsqkdfledrraavdtycrhnygvgesftvq

SCOP Domain Coordinates for d1hqrb2:

Click to download the PDB-style file with coordinates for d1hqrb2.
(The format of our PDB-style files is described here.)

Timeline for d1hqrb2: