SCOPe 2.06: Domain d1hqra2: 1hqr A:3-81

Lineage for d1hqra2 (1hqr A:3-81)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)

7. Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [88809] (13 PDB entries)

8. Domain d1hqra2: 1hqr A:3-81 [38187]
   Other proteins in same PDB: d1hqra1, d1hqrb1, d1hqrb2, d1hqrd1, d1hqrd2
   complexed with zn

Details for d1hqra2

PDB Entry: 1hqr, 3.2 Å

PDB Description: crystal structure of a superantigen bound to the high-affinity, zinc-dependent site on mhc class ii

PDB Compounds: (A:) hla-dr alpha chain

SCOPe Domain Sequences for d1hqra2:

Sequence; same for both SEQRES and ATOM records:

>d1hqra2 d.19.1.1 (A:3-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR2 [TaxId: 9606]}
eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan
iavdkanleimtkrsnytp

Timeline for d1hqra2:

• d1hqra2 first appeared (with stable ids) in SCOP 1.55
  
• d1hqra2 appears in SCOPe 2.05
  
• d1hqra2 appears in SCOPe 2.07
  
• d1hqra2 appears in the current release, SCOPe 2.08