Lineage for d1bx2e2 (1bx2 E:3-92)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 78647Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 78648Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 78649Family d.19.1.1: MHC antigen-recognition domain [54453] (7 proteins)
  6. 78785Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (10 species)
  7. 78815Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [54461] (3 PDB entries)
  8. 78823Domain d1bx2e2: 1bx2 E:3-92 [38186]
    Other proteins in same PDB: d1bx2a1, d1bx2b1, d1bx2d1, d1bx2e1

Details for d1bx2e2

PDB Entry: 1bx2 (more details), 2.6 Å

PDB Description: crystal structure of hla-dr2 (dra*0101,drb1*1501) complexed with a peptide from human myelin basic protein

SCOP Domain Sequences for d1bx2e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bx2e2 d.19.1.1 (E:3-92) MHC class II, N-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR2}
trprflwqpkrechffngtervrfldryfynqeesvrfdsdvgefravtelgrpdaeywn
sqkdileqaraavdtycrhnygvvesftvq

SCOP Domain Coordinates for d1bx2e2:

Click to download the PDB-style file with coordinates for d1bx2e2.
(The format of our PDB-style files is described here.)

Timeline for d1bx2e2: