Lineage for d1bx2b2 (1bx2 B:3-92)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 501112Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 501113Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 501114Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 501462Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 501493Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [88822] (10 PDB entries)
  8. 501504Domain d1bx2b2: 1bx2 B:3-92 [38184]
    Other proteins in same PDB: d1bx2a1, d1bx2a2, d1bx2b1, d1bx2d1, d1bx2d2, d1bx2e1

Details for d1bx2b2

PDB Entry: 1bx2 (more details), 2.6 Å

PDB Description: crystal structure of hla-dr2 (dra*0101,drb1*1501) complexed with a peptide from human myelin basic protein

SCOP Domain Sequences for d1bx2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bx2b2 d.19.1.1 (B:3-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR2}
trprflwqpkrechffngtervrfldryfynqeesvrfdsdvgefravtelgrpdaeywn
sqkdileqaraavdtycrhnygvvesftvq

SCOP Domain Coordinates for d1bx2b2:

Click to download the PDB-style file with coordinates for d1bx2b2.
(The format of our PDB-style files is described here.)

Timeline for d1bx2b2: