Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species) |
Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [88809] (13 PDB entries) |
Domain d1fv1d2: 1fv1 D:4-81 [38181] Other proteins in same PDB: d1fv1a1, d1fv1b1, d1fv1b2, d1fv1d1, d1fv1e1, d1fv1e2 complexed with gol, so4 |
PDB Entry: 1fv1 (more details), 1.9 Å
SCOPe Domain Sequences for d1fv1d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fv1d2 d.19.1.1 (D:4-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR2 [TaxId: 9606]} ehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalani avdkanleimtkrsnytp
Timeline for d1fv1d2: