![]() | Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins) |
![]() | Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (12 species) |
![]() | Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [54461] (3 PDB entries) |
![]() | Domain d1fv1d2: 1fv1 D:4-81 [38181] Other proteins in same PDB: d1fv1a1, d1fv1b1, d1fv1d1, d1fv1e1 |
PDB Entry: 1fv1 (more details), 1.9 Å
SCOP Domain Sequences for d1fv1d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fv1d2 d.19.1.1 (D:4-81) MHC class II, N-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR2} ehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalani avdkanleimtkrsnytp
Timeline for d1fv1d2: