SCOP 1.55: Domain d1fv1d2: 1fv1 D:4-81

Lineage for d1fv1d2 (1fv1 D:4-81)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (7 proteins)

6. Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (9 species)

7. Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [54461] (3 PDB entries)

8. Domain d1fv1d2: 1fv1 D:4-81 [38181]
   Other proteins in same PDB: d1fv1a1, d1fv1b1, d1fv1d1, d1fv1e1

Details for d1fv1d2

PDB Entry: 1fv1, 1.9 Å

PDB Description: structural basis for the binding of an immunodominant peptide from myelin basic protein in different registers by two hla-dr2 alleles

SCOP Domain Sequences for d1fv1d2:

Sequence; same for both SEQRES and ATOM records:

>d1fv1d2 d.19.1.1 (D:4-81) MHC class II, N-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR2}
ehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalani
avdkanleimtkrsnytp

Timeline for d1fv1d2:

• d1fv1d2 appears in SCOP 1.57
  
• d1fv1d2 appears in the current release, SCOPe 2.08