Lineage for d1fv1b2 (1fv1 B:1-92)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1897191Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1897192Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1897193Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1897932Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 1897972Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [88822] (13 PDB entries)
    Uniprot P04229 30-219
  8. 1897973Domain d1fv1b2: 1fv1 B:1-92 [38180]
    Other proteins in same PDB: d1fv1a1, d1fv1a2, d1fv1b1, d1fv1d1, d1fv1d2, d1fv1e1
    complexed with gol, so4

Details for d1fv1b2

PDB Entry: 1fv1 (more details), 1.9 Å

PDB Description: structural basis for the binding of an immunodominant peptide from myelin basic protein in different registers by two hla-dr2 alleles
PDB Compounds: (B:) major histocompatibility complex beta chain

SCOPe Domain Sequences for d1fv1b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fv1b2 d.19.1.1 (B:1-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR2 [TaxId: 9606]}
gdtrprflqqdkyechffngtervrflhrdiynqeedlrfdsdvgeyravtelgrpdaey
wnsqkdfledrraavdtycrhnygvgesftvq

SCOPe Domain Coordinates for d1fv1b2:

Click to download the PDB-style file with coordinates for d1fv1b2.
(The format of our PDB-style files is described here.)

Timeline for d1fv1b2: