Lineage for d1fv1b2 (1fv1 B:1-92)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 409342Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 409343Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 409344Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins)
  6. 409679Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 409710Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [88822] (6 PDB entries)
  8. 409711Domain d1fv1b2: 1fv1 B:1-92 [38180]
    Other proteins in same PDB: d1fv1a1, d1fv1a2, d1fv1b1, d1fv1d1, d1fv1d2, d1fv1e1

Details for d1fv1b2

PDB Entry: 1fv1 (more details), 1.9 Å

PDB Description: structural basis for the binding of an immunodominant peptide from myelin basic protein in different registers by two hla-dr2 alleles

SCOP Domain Sequences for d1fv1b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fv1b2 d.19.1.1 (B:1-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR2}
gdtrprflqqdkyechffngtervrflhrdiynqeedlrfdsdvgeyravtelgrpdaey
wnsqkdfledrraavdtycrhnygvgesftvq

SCOP Domain Coordinates for d1fv1b2:

Click to download the PDB-style file with coordinates for d1fv1b2.
(The format of our PDB-style files is described here.)

Timeline for d1fv1b2: