Lineage for d1sebf2 (1seb F:1-92)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1197982Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1197983Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1197984Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1198561Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 1198571Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88821] (13 PDB entries)
  8. 1198588Domain d1sebf2: 1seb F:1-92 [38178]
    Other proteins in same PDB: d1seba1, d1seba2, d1sebb1, d1sebd1, d1sebd2, d1sebe1, d1sebe2, d1sebf1, d1sebh1, d1sebh2

Details for d1sebf2

PDB Entry: 1seb (more details), 2.7 Å

PDB Description: complex of the human mhc class ii glycoprotein hla-dr1 and the bacterial superantigen seb
PDB Compounds: (F:) hla class II histocompatibility antigen

SCOPe Domain Sequences for d1sebf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sebf2 d.19.1.1 (F:1-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]}
gdtrprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaey
wnsqkdlleqrraavdtycrhnygvgesftvq

SCOPe Domain Coordinates for d1sebf2:

Click to download the PDB-style file with coordinates for d1sebf2.
(The format of our PDB-style files is described here.)

Timeline for d1sebf2: