Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins) |
Protein Class II MHC beta chain, N-terminal domain [88819] (15 species) |
Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88821] (13 PDB entries) |
Domain d1sebf2: 1seb F:1-92 [38178] Other proteins in same PDB: d1seba1, d1seba2, d1sebb1, d1sebd1, d1sebd2, d1sebe1, d1sebe2, d1sebf1, d1sebh1, d1sebh2 |
PDB Entry: 1seb (more details), 2.7 Å
SCOP Domain Sequences for d1sebf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sebf2 d.19.1.1 (F:1-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]} gdtrprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaey wnsqkdlleqrraavdtycrhnygvgesftvq
Timeline for d1sebf2: