Lineage for d1sebf2 (1seb F:1-92)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 409342Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 409343Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 409344Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins)
  6. 409679Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 409689Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88821] (13 PDB entries)
  8. 409706Domain d1sebf2: 1seb F:1-92 [38178]
    Other proteins in same PDB: d1seba1, d1seba2, d1sebb1, d1sebd1, d1sebd2, d1sebe1, d1sebe2, d1sebf1, d1sebh1, d1sebh2

Details for d1sebf2

PDB Entry: 1seb (more details), 2.7 Å

PDB Description: complex of the human mhc class ii glycoprotein hla-dr1 and the bacterial superantigen seb

SCOP Domain Sequences for d1sebf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sebf2 d.19.1.1 (F:1-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR1}
gdtrprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaey
wnsqkdlleqrraavdtycrhnygvgesftvq

SCOP Domain Coordinates for d1sebf2:

Click to download the PDB-style file with coordinates for d1sebf2.
(The format of our PDB-style files is described here.)

Timeline for d1sebf2: