Lineage for d1seba2 (1seb A:1-81)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 255210Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 255211Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 255212Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins)
  6. 255405Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (12 species)
  7. 255412Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [54460] (11 PDB entries)
  8. 255435Domain d1seba2: 1seb A:1-81 [38175]
    Other proteins in same PDB: d1seba1, d1sebb1, d1sebd1, d1sebd2, d1sebe1, d1sebf1, d1sebh1, d1sebh2

Details for d1seba2

PDB Entry: 1seb (more details), 2.7 Å

PDB Description: complex of the human mhc class ii glycoprotein hla-dr1 and the bacterial superantigen seb

SCOP Domain Sequences for d1seba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1seba2 d.19.1.1 (A:1-81) MHC class II, N-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR1}
ikeehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgal
aniavdkanleimtkrsnytp

SCOP Domain Coordinates for d1seba2:

Click to download the PDB-style file with coordinates for d1seba2.
(The format of our PDB-style files is described here.)

Timeline for d1seba2: