Lineage for d1dlhe2 (1dlh E:3-92)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 856282Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 856283Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 856284Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 856861Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 856871Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88821] (13 PDB entries)
  8. 856886Domain d1dlhe2: 1dlh E:3-92 [38174]
    Other proteins in same PDB: d1dlha1, d1dlha2, d1dlhb1, d1dlhd1, d1dlhd2, d1dlhe1
    complexed with nag

Details for d1dlhe2

PDB Entry: 1dlh (more details), 2.8 Å

PDB Description: crystal structure of the human class ii mhc protein hla-dr1 complexed with an influenza virus peptide
PDB Compounds: (E:) class II histocompatibility antigen (hla-dr1) (beta chain)

SCOP Domain Sequences for d1dlhe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dlhe2 d.19.1.1 (E:3-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]}
trprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaeywn
sqkdlleqrraavdtycrhnygvgesftvq

SCOP Domain Coordinates for d1dlhe2:

Click to download the PDB-style file with coordinates for d1dlhe2.
(The format of our PDB-style files is described here.)

Timeline for d1dlhe2: