Lineage for d1dlhe2 (1dlh E:3-92)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 31165Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 31166Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 31167Family d.19.1.1: MHC antigen-recognition domain [54453] (7 proteins)
  6. 31290Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (9 species)
  7. 31294Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [54460] (5 PDB entries)
  8. 31310Domain d1dlhe2: 1dlh E:3-92 [38174]
    Other proteins in same PDB: d1dlha1, d1dlhb1, d1dlhd1, d1dlhe1

Details for d1dlhe2

PDB Entry: 1dlh (more details), 2.8 Å

PDB Description: crystal structure of the human class ii mhc protein hla-dr1 complexed with an influenza virus peptide

SCOP Domain Sequences for d1dlhe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dlhe2 d.19.1.1 (E:3-92) MHC class II, N-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR1}
trprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaeywn
sqkdlleqrraavdtycrhnygvgesftvq

SCOP Domain Coordinates for d1dlhe2:

Click to download the PDB-style file with coordinates for d1dlhe2.
(The format of our PDB-style files is described here.)

Timeline for d1dlhe2: