Lineage for d1dlhd2 (1dlh D:3-81)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1897191Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1897192Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1897193Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1897796Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 1897806Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88808] (18 PDB entries)
    Uniprot P01903 28-207
  8. 1897829Domain d1dlhd2: 1dlh D:3-81 [38173]
    Other proteins in same PDB: d1dlha1, d1dlhb1, d1dlhb2, d1dlhd1, d1dlhe1, d1dlhe2
    complexed with nag, ndg

Details for d1dlhd2

PDB Entry: 1dlh (more details), 2.8 Å

PDB Description: crystal structure of the human class ii mhc protein hla-dr1 complexed with an influenza virus peptide
PDB Compounds: (D:) class II histocompatibility antigen (hla-dr1) (alpha chain)

SCOPe Domain Sequences for d1dlhd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dlhd2 d.19.1.1 (D:3-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]}
eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan
iavdkanleimtkrsnytp

SCOPe Domain Coordinates for d1dlhd2:

Click to download the PDB-style file with coordinates for d1dlhd2.
(The format of our PDB-style files is described here.)

Timeline for d1dlhd2: