Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins) |
Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species) |
Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88808] (15 PDB entries) |
Domain d1dlhd2: 1dlh D:3-81 [38173] Other proteins in same PDB: d1dlha1, d1dlhb1, d1dlhb2, d1dlhd1, d1dlhe1, d1dlhe2 |
PDB Entry: 1dlh (more details), 2.8 Å
SCOP Domain Sequences for d1dlhd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dlhd2 d.19.1.1 (D:3-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR1} eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan iavdkanleimtkrsnytp
Timeline for d1dlhd2: