Lineage for d1dlha2 (1dlh A:3-81)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 326693Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 326694Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 326695Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins)
  6. 326895Protein Class II MHC alpha chain, N-terminal domain [88806] (13 species)
  7. 326900Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88808] (11 PDB entries)
  8. 326909Domain d1dlha2: 1dlh A:3-81 [38171]
    Other proteins in same PDB: d1dlha1, d1dlhb1, d1dlhb2, d1dlhd1, d1dlhe1, d1dlhe2

Details for d1dlha2

PDB Entry: 1dlh (more details), 2.8 Å

PDB Description: crystal structure of the human class ii mhc protein hla-dr1 complexed with an influenza virus peptide

SCOP Domain Sequences for d1dlha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dlha2 d.19.1.1 (A:3-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR1}
eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan
iavdkanleimtkrsnytp

SCOP Domain Coordinates for d1dlha2:

Click to download the PDB-style file with coordinates for d1dlha2.
(The format of our PDB-style files is described here.)

Timeline for d1dlha2: