SCOP 1.67: Domain d2sebb2: 2seb B:2-92

Lineage for d2sebb2 (2seb B:2-92)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins)

6. Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)

7. Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88821] (13 PDB entries)

8. Domain d2sebb2: 2seb B:2-92 [38168]
   Other proteins in same PDB: d2seba1, d2seba2, d2sebb1, d2sebd1, d2sebd2
   complexed with nag

Details for d2sebb2

PDB Entry: 2seb, 2.5 Å

PDB Description: x-ray crystal structure of hla-dr4 complexed with a peptide from human collagen ii

SCOP Domain Sequences for d2sebb2:

Sequence; same for both SEQRES and ATOM records:

>d2sebb2 d.19.1.1 (B:2-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR1}
dtrprfleqvkhechffngtervrfldryfyhqeeyvrfdsdvgeyravtelgrpdaeyw
nsqkdlleqkraavdtycrhnygvgesftvq

Timeline for d2sebb2:

• d2sebb2 first appeared (with stable ids) in SCOP 1.55
  
• d2sebb2 appears in SCOP 1.65
  
• d2sebb2 appears in SCOP 1.69
  
• d2sebb2 appears in the current release, SCOPe 2.08