Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins) |
Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (12 species) |
Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [54460] (11 PDB entries) |
Domain d2sebb2: 2seb B:2-92 [38168] Other proteins in same PDB: d2seba1, d2sebb1, d2sebd1, d2sebd2 complexed with nag |
PDB Entry: 2seb (more details), 2.5 Å
SCOP Domain Sequences for d2sebb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2sebb2 d.19.1.1 (B:2-92) MHC class II, N-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR1} dtrprfleqvkhechffngtervrfldryfyhqeeyvrfdsdvgeyravtelgrpdaeyw nsqkdlleqkraavdtycrhnygvgesftvq
Timeline for d2sebb2:
View in 3D Domains from other chains: (mouse over for more information) d2seba1, d2seba2, d2sebd1, d2sebd2 |