Lineage for d2sebb2 (2seb B:2-92)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 255210Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 255211Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 255212Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins)
  6. 255405Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (12 species)
  7. 255412Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [54460] (11 PDB entries)
  8. 255428Domain d2sebb2: 2seb B:2-92 [38168]
    Other proteins in same PDB: d2seba1, d2sebb1, d2sebd1, d2sebd2
    complexed with nag

Details for d2sebb2

PDB Entry: 2seb (more details), 2.5 Å

PDB Description: x-ray crystal structure of hla-dr4 complexed with a peptide from human collagen ii

SCOP Domain Sequences for d2sebb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2sebb2 d.19.1.1 (B:2-92) MHC class II, N-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR1}
dtrprfleqvkhechffngtervrfldryfyhqeeyvrfdsdvgeyravtelgrpdaeyw
nsqkdlleqkraavdtycrhnygvgesftvq

SCOP Domain Coordinates for d2sebb2:

Click to download the PDB-style file with coordinates for d2sebb2.
(The format of our PDB-style files is described here.)

Timeline for d2sebb2: