Lineage for d2seba2 (2seb A:1-81)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 856282Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 856283Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 856284Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 856736Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 856746Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88808] (15 PDB entries)
    Uniprot P01903 28-207
  8. 856759Domain d2seba2: 2seb A:1-81 [38167]
    Other proteins in same PDB: d2seba1, d2sebb1, d2sebb2, d2sebd1, d2sebd2
    complexed with nag

Details for d2seba2

PDB Entry: 2seb (more details), 2.5 Å

PDB Description: x-ray crystal structure of hla-dr4 complexed with a peptide from human collagen ii
PDB Compounds: (A:) hla class II histocompatibility antigen

SCOP Domain Sequences for d2seba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2seba2 d.19.1.1 (A:1-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]}
ikeehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgal
aniavdkanleimtkrsnytp

SCOP Domain Coordinates for d2seba2:

Click to download the PDB-style file with coordinates for d2seba2.
(The format of our PDB-style files is described here.)

Timeline for d2seba2: