Lineage for d1aqdh2 (1aqd H:4-92)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 600225Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 600226Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 600227Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 600593Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 600603Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88821] (13 PDB entries)
  8. 600609Domain d1aqdh2: 1aqd H:4-92 [38164]
    Other proteins in same PDB: d1aqda1, d1aqda2, d1aqdb1, d1aqdd1, d1aqdd2, d1aqde1, d1aqdg1, d1aqdg2, d1aqdh1, d1aqdj1, d1aqdj2, d1aqdk1

Details for d1aqdh2

PDB Entry: 1aqd (more details), 2.45 Å

PDB Description: hla-dr1 (dra, drb1 0101) human class ii histocompatibility protein (extracellular domain) complexed with endogenous peptide

SCOP Domain Sequences for d1aqdh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aqdh2 d.19.1.1 (H:4-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR1}
rprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaeywns
qkdlleqrraavdtycrhnygvgesftvq

SCOP Domain Coordinates for d1aqdh2:

Click to download the PDB-style file with coordinates for d1aqdh2.
(The format of our PDB-style files is described here.)

Timeline for d1aqdh2: