SCOP 1.63: Domain d1aqdg2: 1aqd G:3-81

Lineage for d1aqdg2 (1aqd G:3-81)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins)

6. Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (12 species)

7. Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [54460] (11 PDB entries)

8. Domain d1aqdg2: 1aqd G:3-81 [38163]
   Other proteins in same PDB: d1aqda1, d1aqdb1, d1aqdd1, d1aqde1, d1aqdg1, d1aqdh1, d1aqdj1, d1aqdk1

Details for d1aqdg2

PDB Entry: 1aqd, 2.45 Å

PDB Description: hla-dr1 (dra, drb1 0101) human class ii histocompatibility protein (extracellular domain) complexed with endogenous peptide

SCOP Domain Sequences for d1aqdg2:

Sequence; same for both SEQRES and ATOM records:

>d1aqdg2 d.19.1.1 (G:3-81) MHC class II, N-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR1}
eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan
iavdkanleimtkrsnytp

Timeline for d1aqdg2:

• d1aqdg2 first appeared (with stable ids) in SCOP 1.55
  
• d1aqdg2 appears in SCOP 1.61
  
• d1aqdg2 appears in SCOP 1.65
  
• d1aqdg2 appears in the current release, SCOPe 2.08