Lineage for d1aqde2 (1aqd E:4-92)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 131823Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 131824Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 131825Family d.19.1.1: MHC antigen-recognition domain [54453] (9 proteins)
  6. 131977Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (11 species)
  7. 131984Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [54460] (6 PDB entries)
  8. 131988Domain d1aqde2: 1aqd E:4-92 [38162]
    Other proteins in same PDB: d1aqda1, d1aqdb1, d1aqdd1, d1aqde1, d1aqdg1, d1aqdh1, d1aqdj1, d1aqdk1

Details for d1aqde2

PDB Entry: 1aqd (more details), 2.45 Å

PDB Description: hla-dr1 (dra, drb1 0101) human class ii histocompatibility protein (extracellular domain) complexed with endogenous peptide

SCOP Domain Sequences for d1aqde2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aqde2 d.19.1.1 (E:4-92) MHC class II, N-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR1}
rprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaeywns
qkdlleqrraavdtycrhnygvgesftvq

SCOP Domain Coordinates for d1aqde2:

Click to download the PDB-style file with coordinates for d1aqde2.
(The format of our PDB-style files is described here.)

Timeline for d1aqde2: