SCOPe 2.08: Domain d1aqdd2: 1aqd D:3-81

Lineage for d1aqdd2 (1aqd D:3-81)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)

7. Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88808] (18 PDB entries)
   Uniprot P01903 28-207

8. Domain d1aqdd2: 1aqd D:3-81 [38161]
   Other proteins in same PDB: d1aqda1, d1aqdb1, d1aqdb2, d1aqdd1, d1aqde1, d1aqde2, d1aqdg1, d1aqdh1, d1aqdh2, d1aqdj1, d1aqdk1, d1aqdk2
   fragment; missing more than one-third of the common structure and/or sequence

Details for d1aqdd2

PDB Entry: 1aqd, 2.45 Å

PDB Description: hla-dr1 (dra, drb1 0101) human class ii histocompatibility protein (extracellular domain) complexed with endogenous peptide

PDB Compounds: (D:) hla-dr1 class II histocompatibility protein

SCOPe Domain Sequences for d1aqdd2:

Sequence; same for both SEQRES and ATOM records:

>d1aqdd2 d.19.1.1 (D:3-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]}
eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan
iavdkanleimtkrsnytp

Timeline for d1aqdd2:

• d1aqdd2 first appeared (with stable ids) in SCOP 1.55
  
• d1aqdd2 appears in SCOPe 2.07