SCOPe 2.02: Domain d1aqdb2: 1aqd B:4-92

Lineage for d1aqdb2 (1aqd B:4-92)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)

7. Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88821] (13 PDB entries)

8. Domain d1aqdb2: 1aqd B:4-92 [38160]
   Other proteins in same PDB: d1aqda1, d1aqda2, d1aqdb1, d1aqdd1, d1aqdd2, d1aqde1, d1aqdg1, d1aqdg2, d1aqdh1, d1aqdj1, d1aqdj2, d1aqdk1

Details for d1aqdb2

PDB Entry: 1aqd, 2.45 Å

PDB Description: hla-dr1 (dra, drb1 0101) human class ii histocompatibility protein (extracellular domain) complexed with endogenous peptide

PDB Compounds: (B:) hla-dr1 class II histocompatibility protein

SCOPe Domain Sequences for d1aqdb2:

Sequence; same for both SEQRES and ATOM records:

>d1aqdb2 d.19.1.1 (B:4-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]}
rprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaeywns
qkdlleqrraavdtycrhnygvgesftvq

Timeline for d1aqdb2:

• d1aqdb2 first appeared (with stable ids) in SCOP 1.55
  
• d1aqdb2 appears in SCOPe 2.01
  
• d1aqdb2 appears in SCOPe 2.03
  
• d1aqdb2 appears in the current release, SCOPe 2.08