Lineage for d1hdma2 (1hdm A:13-93)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1197982Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1197983Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1197984Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1198436Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 1198437Species Human (Homo sapiens), HLA-DM [TaxId:9606] [88807] (1 PDB entry)
  8. 1198438Domain d1hdma2: 1hdm A:13-93 [38157]
    Other proteins in same PDB: d1hdma1, d1hdmb1, d1hdmb2

Details for d1hdma2

PDB Entry: 1hdm (more details), 2.5 Å

PDB Description: histocompatibility antigen hla-dm
PDB Compounds: (A:) protein (class II histocompatibility antigen, m alpha chain)

SCOPe Domain Sequences for d1hdma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hdma2 d.19.1.1 (A:13-93) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DM [TaxId: 9606]}
lqnhtflhtvycqdgspsvglseaydedqlfffdfsqntrvprlpefadwaqeqgdailf
dkefcewmiqqipkldgkipv

SCOPe Domain Coordinates for d1hdma2:

Click to download the PDB-style file with coordinates for d1hdma2.
(The format of our PDB-style files is described here.)

Timeline for d1hdma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hdma1