Lineage for d1hdma2 (1hdm A:13-93)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 255210Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 255211Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 255212Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins)
  6. 255405Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (12 species)
  7. 255406Species Human (Homo sapiens), HLA-DM [TaxId:9606] [54459] (1 PDB entry)
  8. 255407Domain d1hdma2: 1hdm A:13-93 [38157]
    Other proteins in same PDB: d1hdma1, d1hdmb1

Details for d1hdma2

PDB Entry: 1hdm (more details), 2.5 Å

PDB Description: histocompatibility antigen hla-dm

SCOP Domain Sequences for d1hdma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hdma2 d.19.1.1 (A:13-93) MHC class II, N-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DM}
lqnhtflhtvycqdgspsvglseaydedqlfffdfsqntrvprlpefadwaqeqgdailf
dkefcewmiqqipkldgkipv

SCOP Domain Coordinates for d1hdma2:

Click to download the PDB-style file with coordinates for d1hdma2.
(The format of our PDB-style files is described here.)

Timeline for d1hdma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hdma1