Lineage for d1frta2 (1frt A:1-178)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1897191Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1897192Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1897193Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1898068Protein Fc (IgG) receptor, alpha-1 and alpha-2 domains [54454] (2 species)
    class I MHC-related
  7. 1898071Species Norway rat (Rattus norvegicus) [TaxId:10116] [54455] (3 PDB entries)
  8. 1898076Domain d1frta2: 1frt A:1-178 [38154]
    Other proteins in same PDB: d1frta1, d1frtb_, d1frtc1, d1frtc2
    complexed with nag

Details for d1frta2

PDB Entry: 1frt (more details), 4.5 Å

PDB Description: crystal structure of the complex of rat neonatal fc receptor with fc
PDB Compounds: (A:) neonatal fc receptor

SCOPe Domain Sequences for d1frta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1frta2 d.19.1.1 (A:1-178) Fc (IgG) receptor, alpha-1 and alpha-2 domains {Norway rat (Rattus norvegicus) [TaxId: 10116]}
aeprlplmyhlaavsdlstglpsfwatgwlgaqqyltynnlrqeadpcgawiwenqvswy
wekettdlkskeqlfleairtlenqingtftlqgllgcelapdnsslptavfalngeefm
rfnprtgnwsgewpetdivgnlwmkqpeaarkeseflltscperllghlergrqnlew

SCOPe Domain Coordinates for d1frta2:

Click to download the PDB-style file with coordinates for d1frta2.
(The format of our PDB-style files is described here.)

Timeline for d1frta2: