Lineage for d1i1aa2 (1i1a A:5-178)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 856282Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 856283Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 856284Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 856991Protein Fc (IgG) receptor, alpha-1 and alpha-2 domains [54454] (2 species)
    class I MHC-related
  7. 856994Species Rat (Rattus norvegicus) [TaxId:10116] [54455] (3 PDB entries)
  8. 856998Domain d1i1aa2: 1i1a A:5-178 [38153]
    Other proteins in same PDB: d1i1aa1, d1i1ab_, d1i1ac1, d1i1ac2, d1i1ad1, d1i1ad2
    complexed with cys, fuc, man, nag; mutant

Details for d1i1aa2

PDB Entry: 1i1a (more details), 2.8 Å

PDB Description: crystal structure of the neonatal fc receptor complexed with a heterodimeric fc
PDB Compounds: (A:) neonatal fc receptor a

SCOP Domain Sequences for d1i1aa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i1aa2 d.19.1.1 (A:5-178) Fc (IgG) receptor, alpha-1 and alpha-2 domains {Rat (Rattus norvegicus) [TaxId: 10116]}
lplmyhlaavsdlstglpsfwatgwlgaqqyltynnlrqeadpcgawiwenqvswyweke
ttdlkskeqlfleairtlenqingtftlqgllgcelapdnsslptavfalngeefmrfnp
rtgnwsgewpetdivgnlwmkqpeaarkeseflltscperllghlergrqnlew

SCOP Domain Coordinates for d1i1aa2:

Click to download the PDB-style file with coordinates for d1i1aa2.
(The format of our PDB-style files is described here.)

Timeline for d1i1aa2: