Lineage for d1i1aa2 (1i1a A:5-178)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 131823Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 131824Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 131825Family d.19.1.1: MHC antigen-recognition domain [54453] (9 proteins)
  6. 131836Protein Fc (IgG) receptor, alpha-1 and alpha-2 domains [54454] (1 species)
  7. 131837Species Rat (Rattus norvegicus) [TaxId:10116] [54455] (3 PDB entries)
  8. 131841Domain d1i1aa2: 1i1a A:5-178 [38153]
    Other proteins in same PDB: d1i1aa1, d1i1ab1, d1i1ac1, d1i1ac2, d1i1ad1, d1i1ad2

Details for d1i1aa2

PDB Entry: 1i1a (more details), 2.8 Å

PDB Description: crystal structure of the neonatal fc receptor complexed with a heterodimeric fc

SCOP Domain Sequences for d1i1aa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i1aa2 d.19.1.1 (A:5-178) Fc (IgG) receptor, alpha-1 and alpha-2 domains {Rat (Rattus norvegicus)}
lplmyhlaavsdlstglpsfwatgwlgaqqyltynnlrqeadpcgawiwenqvswyweke
ttdlkskeqlfleairtlenqingtftlqgllgcelapdnsslptavfalngeefmrfnp
rtgnwsgewpetdivgnlwmkqpeaarkeseflltscperllghlergrqnlew

SCOP Domain Coordinates for d1i1aa2:

Click to download the PDB-style file with coordinates for d1i1aa2.
(The format of our PDB-style files is described here.)

Timeline for d1i1aa2: