Class d: Alpha and beta proteins (a+b) [53931] (212 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins) |
Protein Fc (IgG) receptor, alpha-1 and alpha-2 domains [54454] (1 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [54455] (3 PDB entries) |
Domain d3frue2: 3fru E:1-178 [38152] Other proteins in same PDB: d3frua1, d3frub1, d3fruc1, d3frud1, d3frue1, d3fruf1 |
PDB Entry: 3fru (more details), 2.2 Å
SCOP Domain Sequences for d3frue2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3frue2 d.19.1.1 (E:1-178) Fc (IgG) receptor, alpha-1 and alpha-2 domains {Rat (Rattus norvegicus)} aeprlplmyhlaavsdlstglpsfwatgwlgaqqyltynnlrqeadpcgawiwenqvswy wekettdlkskeqlfleairtlenqingtftlqgllgcelapdnsslptavfalngeefm rfnprtgnwsgewpetdivgnlwmkqpeaarkeseflltscperllghlergrqnlew
Timeline for d3frue2: