Lineage for d3fruc2 (3fru C:1-178)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) 
Family d.19.1.1: MHC antigen-recognition domain [54453] (7 proteins) 
Protein Fc (IgG) receptor, alpha-1 and alpha-2 domains [54454] (1 species) Species Rat (Rattus norvegicus) [TaxId:10116] [54455] (3 PDB entries) 
Domain d3fruc2: 3fru C:1-178 [38151]
Other proteins in same PDB: d3frua1, d3frub1, d3fruc1, d3frud1, d3frue1, d3fruf1
Details for d3fruc2
PDB Entry: 3fru (more details), 2.2 Å
PDB Description: neonatal fc receptor, ph 6.5
SCOP Domain Sequences for d3fruc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fruc2 d.19.1.1 (C:1-178) Fc (IgG) receptor, alpha-1 and alpha-2 domains {Rat (Rattus norvegicus)}
aeprlplmyhlaavsdlstglpsfwatgwlgaqqyltynnlrqeadpcgawiwenqvswy
wekettdlkskeqlfleairtlenqingtftlqgllgcelapdnsslptavfalngeefm
rfnprtgnwsgewpetdivgnlwmkqpeaarkeseflltscperllghlergrqnlew
SCOP Domain Coordinates for d3fruc2:
Click to download the PDB-style file with coordinates for d3fruc2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3fruc2:
View in 3D
