Lineage for d3frua2 (3fru A:1-178)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 31165Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 31166Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 31167Family d.19.1.1: MHC antigen-recognition domain [54453] (7 proteins)
  6. 31172Protein Fc (IgG) receptor, alpha-1 and alpha-2 domains [54454] (1 species)
  7. 31173Species Rat (Rattus norvegicus) [TaxId:10116] [54455] (3 PDB entries)
  8. 31174Domain d3frua2: 3fru A:1-178 [38150]
    Other proteins in same PDB: d3frua1, d3frub1, d3fruc1, d3frud1, d3frue1, d3fruf1

Details for d3frua2

PDB Entry: 3fru (more details), 2.2 Å

PDB Description: neonatal fc receptor, ph 6.5

SCOP Domain Sequences for d3frua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3frua2 d.19.1.1 (A:1-178) Fc (IgG) receptor, alpha-1 and alpha-2 domains {Rat (Rattus norvegicus)}
aeprlplmyhlaavsdlstglpsfwatgwlgaqqyltynnlrqeadpcgawiwenqvswy
wekettdlkskeqlfleairtlenqingtftlqgllgcelapdnsslptavfalngeefm
rfnprtgnwsgewpetdivgnlwmkqpeaarkeseflltscperllghlergrqnlew

SCOP Domain Coordinates for d3frua2:

Click to download the PDB-style file with coordinates for d3frua2.
(The format of our PDB-style files is described here.)

Timeline for d3frua2: