Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily) consists of two non-similar domains Domain 1 has parallel sheet of 5 strands, order 32415 Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest |
Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families) |
Family c.90.1.1: Tetrapyrrole methylase [53791] (8 proteins) Pfam PF00590 |
Protein automated matches [190790] (4 species) not a true protein |
Species Salmonella typhimurium [TaxId:90371] [381349] (8 PDB entries) |
Domain d6pr1a3: 6pr1 A:216-457 [381465] Other proteins in same PDB: d6pr1a1, d6pr1a2, d6pr1b1, d6pr1b2 automated match to d1pjqa2 complexed with cl, sah |
PDB Entry: 6pr1 (more details), 1.82 Å
SCOPe Domain Sequences for d6pr1a3:
Sequence, based on SEQRES records: (download)
>d6pr1a3 c.90.1.1 (A:216-457) automated matches {Salmonella typhimurium [TaxId: 90371]} gevvlvgagpgdaglltlkglqqiqqadivvydrlvsddimnlvardadrvfvgkragyh cvpqeeinqillreaqkgkrvvrlkggdpfifgrggeeletlchagipfsvvpgitaasg csaysgiplthrdyaqsvrlvtghlktggeldwenlaaekqtlvfymglnqaatiqekli afgmqadmpvalvengtsvkqrvvhgvltqlgelaqqvespaliivgrvvalrdklnwfs nh
>d6pr1a3 c.90.1.1 (A:216-457) automated matches {Salmonella typhimurium [TaxId: 90371]} gevvlvgagpgdaglltlkglqqiqqadivvydrlvsddimnlvardadrvfvgvpqeei nqillreaqkgkrvvrlkggdpfifgrggeeletlchagipfsvvpgitaasgcsaysgi plthrdyaqsvrlvtghlktggeldwenlaaekqtlvfymglnqaatiqekliafgmqad mpvalvengtsvkqrvvhgvltqlgelaqqvespaliivgrvvalrdklnwfsnh
Timeline for d6pr1a3: