Lineage for d6p5xb3 (6p5x B:216-457)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2911790Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily)
    consists of two non-similar domains
    Domain 1 has parallel sheet of 5 strands, order 32415
    Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest
  4. 2911791Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families) (S)
  5. 2911792Family c.90.1.1: Tetrapyrrole methylase [53791] (8 proteins)
    Pfam PF00590
  6. 2911972Protein Siroheme synthase CysG, domains 4 and 5 [102682] (2 species)
  7. 2911976Species Salmonella typhimurium [TaxId:90371] [102683] (6 PDB entries)
  8. 2911978Domain d6p5xb3: 6p5x B:216-457 [381384]
    Other proteins in same PDB: d6p5xa1, d6p5xa2, d6p5xb1, d6p5xb2
    automated match to d1pjta2
    complexed with cl, sah, shn

Details for d6p5xb3

PDB Entry: 6p5x (more details), 1.97 Å

PDB Description: sirohydrochlorin-bound s. typhimurium siroheme synthase
PDB Compounds: (B:) Siroheme synthase

SCOPe Domain Sequences for d6p5xb3:

Sequence, based on SEQRES records: (download)

>d6p5xb3 c.90.1.1 (B:216-457) Siroheme synthase CysG, domains 4 and 5 {Salmonella typhimurium [TaxId: 90371]}
gevvlvgagpgdaglltlkglqqiqqadivvydrlvsddimnlvrrdadrvfvgkragyh
cvpqeeinqillreaqkgkrvvrlkggdpfifgrggeeletlchagipfsvvpgitaasg
csaysgiplthrdyaqsvrlvtghlktggeldwenlaaekqtlvfymglnqaatiqekli
afgmqadmpvalvengtsvkqrvvhgvltqlgelaqqvespaliivgrvvalrdklnwfs
nh

Sequence, based on observed residues (ATOM records): (download)

>d6p5xb3 c.90.1.1 (B:216-457) Siroheme synthase CysG, domains 4 and 5 {Salmonella typhimurium [TaxId: 90371]}
gevvlvgagpgdaglltlkglqqiqqadivvydrlvsddimnlvrrdadrvfvgkravpq
eeinqillreaqkgkrvvrlkggdpfifgrggeeletlchagipfsvvpgitaasgcsay
sgiplthrdyaqsvrlvtgggeldwenlaaekqtlvfymglnqaatiqekliafgmqadm
pvalvengtsvkqrvvhgvltqlgelaqqvespaliivgrvvalrdklnwfsnh

SCOPe Domain Coordinates for d6p5xb3:

Click to download the PDB-style file with coordinates for d6p5xb3.
(The format of our PDB-style files is described here.)

Timeline for d6p5xb3: