SCOPe 2.08: Domain d6p7db3: 6p7d B:216-455

Lineage for d6p7db3 (6p7d B:216-455)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily)
   consists of two non-similar domains
   Domain 1 has parallel sheet of 5 strands, order 32415
   Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest

4. Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families)

5. Family c.90.1.1: Tetrapyrrole methylase [53791] (8 proteins)
   Pfam PF00590

6. Protein Siroheme synthase CysG, domains 4 and 5 [102682] (2 species)

7. Species Salmonella typhimurium [TaxId:90371] [102683] (6 PDB entries)

8. Domain d6p7db3: 6p7d B:216-455 [381364]
   Other proteins in same PDB: d6p7da1, d6p7da2, d6p7db1, d6p7db2
   automated match to d1pjqa2
   complexed with cl, sah

Details for d6p7db3

PDB Entry: 6p7d, 2.4 Å

PDB Description: d104n s. typhimurium siroheme synthase

PDB Compounds: (B:) Siroheme synthase

SCOPe Domain Sequences for d6p7db3:

Sequence, based on SEQRES records:

>d6p7db3 c.90.1.1 (B:216-455) Siroheme synthase CysG, domains 4 and 5 {Salmonella typhimurium [TaxId: 90371]}
gevvlvgagpgdaglltlkglqqiqqadivvydrlvsddimnlvrrdadrvfvgkragyh
cvpqeeinqillreaqkgkrvvrlkggdpfifgrggeeletlchagipfsvvpgitaasg
csaysgiplthrdyaqsvrlvtghlktggeldwenlaaekqtlvfymglnqaatiqekli
afgmqadmpvalvengtsvkqrvvhgvltqlgelaqqvespaliivgrvvalrdklnwfs

Sequence, based on observed residues (ATOM records):

>d6p7db3 c.90.1.1 (B:216-455) Siroheme synthase CysG, domains 4 and 5 {Salmonella typhimurium [TaxId: 90371]}
gevvlvgagpgdaglltlkglqqiqqadivvydrlvsddimnlvrrdadrvfvgkravpq
eeinqillreaqkgkrvvrlkggdpfifgrggeeletlchagipfsvvpgitaasgcsay
sgiplthrdyaqsvrlvtgggeldwenlaaekqtlvfymglnqaatiqekliafgmqadm
pvalvengtsvkqrvvhgvltqlgelaqqvespaliivgrvvalrdklnwfs

Timeline for d6p7db3:

• d6p7db3 first appeared in SCOPe 2.07