Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily) consists of two non-similar domains Domain 1 has parallel sheet of 5 strands, order 32415 Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest |
Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families) |
Family c.90.1.1: Tetrapyrrole methylase [53791] (8 proteins) Pfam PF00590 |
Protein Siroheme synthase CysG, domains 4 and 5 [102682] (2 species) |
Species Salmonella typhimurium [TaxId:90371] [102683] (6 PDB entries) |
Domain d6p7db3: 6p7d B:216-455 [381364] Other proteins in same PDB: d6p7da1, d6p7da2, d6p7db1, d6p7db2 automated match to d1pjqa2 complexed with cl, sah |
PDB Entry: 6p7d (more details), 2.4 Å
SCOPe Domain Sequences for d6p7db3:
Sequence, based on SEQRES records: (download)
>d6p7db3 c.90.1.1 (B:216-455) Siroheme synthase CysG, domains 4 and 5 {Salmonella typhimurium [TaxId: 90371]} gevvlvgagpgdaglltlkglqqiqqadivvydrlvsddimnlvrrdadrvfvgkragyh cvpqeeinqillreaqkgkrvvrlkggdpfifgrggeeletlchagipfsvvpgitaasg csaysgiplthrdyaqsvrlvtghlktggeldwenlaaekqtlvfymglnqaatiqekli afgmqadmpvalvengtsvkqrvvhgvltqlgelaqqvespaliivgrvvalrdklnwfs
>d6p7db3 c.90.1.1 (B:216-455) Siroheme synthase CysG, domains 4 and 5 {Salmonella typhimurium [TaxId: 90371]} gevvlvgagpgdaglltlkglqqiqqadivvydrlvsddimnlvrrdadrvfvgkravpq eeinqillreaqkgkrvvrlkggdpfifgrggeeletlchagipfsvvpgitaasgcsay sgiplthrdyaqsvrlvtgggeldwenlaaekqtlvfymglnqaatiqekliafgmqadm pvalvengtsvkqrvvhgvltqlgelaqqvespaliivgrvvalrdklnwfs
Timeline for d6p7db3: