SCOPe 2.08: Domain d5b3zb_: 5b3z B:

Lineage for d5b3zb_ (5b3z B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein D-maltodextrin-binding protein, MBP [53862] (5 species)
   contains a few additional helices in the C-terminal extension; homologous to thiaminase I

7. Species Escherichia coli K-12 [TaxId:83333] [159806] (14 PDB entries)

8. Domain d5b3zb_: 5b3z B: [381272]
   Other proteins in same PDB: d5b3za2
   automated match to d5b3ya_
   has additional insertions and/or extensions that are not grouped together

Details for d5b3zb_

PDB Entry: 5b3z, 2.3 Å

PDB Description: crystal structure of hpin1 ww domain (5-39) fused with maltose-binding protein

PDB Compounds: (B:) Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1,Maltose-binding periplasmic protein

SCOPe Domain Sequences for d5b3zb_:

Sequence; same for both SEQRES and ATOM records:

>d5b3zb_ c.94.1.1 (B:) D-maltodextrin-binding protein, MBP {Escherichia coli K-12 [TaxId: 83333]}
klppgwekrmsrssgrvyyfnhitnasqwerpsgkieegklviwingdkgynglaevgkk
fekdtgikvtvehpdkleekfpqvaatgdgpdiifwahdrfggyaqsgllaeitpdkafq
dklypftwdavryngkliaypiavealsliynkdllpnppktweeipaldkelkakgksa
lmfnlqepyftwpliaadggyafkyengkydikdvgvdnagakagltflvdliknkhmna
dtdysiaeaafnkgetamtingpwawsnidtskvnygvtvlptfkgqpskpfvgvlsagi
naaspnkelakeflenylltdegleavnkdkplgavalksyeeelakdpriaatmenaqk
geimpnipqmsafwyavrtavinaasgrqtvdealkdaqt

Timeline for d5b3zb_:

• d5b3zb_ first appeared in SCOPe 2.07