Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) has additional insertions and/or extensions that are not grouped together |
Protein D-maltodextrin-binding protein, MBP [53862] (5 species) contains a few additional helices in the C-terminal extension; homologous to thiaminase I |
Species Escherichia coli K-12 [TaxId:83333] [159806] (14 PDB entries) |
Domain d5b3zb_: 5b3z B: [381272] Other proteins in same PDB: d5b3za2 automated match to d5b3ya_ has additional insertions and/or extensions that are not grouped together |
PDB Entry: 5b3z (more details), 2.3 Å
SCOPe Domain Sequences for d5b3zb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b3zb_ c.94.1.1 (B:) D-maltodextrin-binding protein, MBP {Escherichia coli K-12 [TaxId: 83333]} klppgwekrmsrssgrvyyfnhitnasqwerpsgkieegklviwingdkgynglaevgkk fekdtgikvtvehpdkleekfpqvaatgdgpdiifwahdrfggyaqsgllaeitpdkafq dklypftwdavryngkliaypiavealsliynkdllpnppktweeipaldkelkakgksa lmfnlqepyftwpliaadggyafkyengkydikdvgvdnagakagltflvdliknkhmna dtdysiaeaafnkgetamtingpwawsnidtskvnygvtvlptfkgqpskpfvgvlsagi naaspnkelakeflenylltdegleavnkdkplgavalksyeeelakdpriaatmenaqk geimpnipqmsafwyavrtavinaasgrqtvdealkdaqt
Timeline for d5b3zb_:
View in 3D Domains from other chains: (mouse over for more information) d5b3za1, d5b3za2, d5b3zc_, d5b3zd_ |