Lineage for d1ndod_ (1ndo D:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.17: Cystatin-like [54402] (5 superfamilies) Superfamily d.17.4: NTF2-like [54427] (4 families) 
Family d.17.4.4: Naphthalene 1,2-dioxygenase beta subunit [54438] (1 protein) Protein Naphthalene 1,2-dioxygenase beta subunit [54439] (1 species) Species Pseudomonas putida [TaxId:303] [54440] (2 PDB entries) 
Domain d1ndod_: 1ndo D: [38122]
Other proteins in same PDB: d1ndoa1, d1ndoa2, d1ndoc1, d1ndoc2, d1ndoe1, d1ndoe2
Details for d1ndod_
PDB Entry: 1ndo (more details), 2.25 Å
PDB Description: napthalene 1,2-dioxygenase
SCOP Domain Sequences for d1ndod_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ndod_ d.17.4.4 (D:) Naphthalene 1,2-dioxygenase beta subunit {Pseudomonas putida}
miniqedklvsahdaeeilrffnchdsalqqeattlltqeahlldiqayrawlehcvgse
vqyqvisrelraaserryklneamnvynenfqqlkvrvehqldpqnwgnspklrftrfit
nvqaamdvndkellhirsnvilhrarrgnqvdvfyaaredkwkrgeggvrklvqrfvdyp
erilqthnlmvfl
SCOP Domain Coordinates for d1ndod_:
Click to download the PDB-style file with coordinates for d1ndod_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ndod_:
- d1ndod_ appears in SCOP 1.57
- d1ndod_ appears in the current release, SCOPe 2.08
View in 3D
