SCOP 1.63: Domain d1ndob_: 1ndo B:

Lineage for d1ndob_ (1ndo B:)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.17: Cystatin-like [54402] (5 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (6 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.4: Naphthalene 1,2-dioxygenase beta subunit [54438] (1 protein)

6. Protein Naphthalene 1,2-dioxygenase beta subunit [54439] (1 species)

7. Species Pseudomonas putida [TaxId:303] [54440] (8 PDB entries)

8. Domain d1ndob_: 1ndo B: [38121]
   Other proteins in same PDB: d1ndoa1, d1ndoa2, d1ndoc1, d1ndoc2, d1ndoe1, d1ndoe2

Details for d1ndob_

PDB Entry: 1ndo, 2.25 Å

PDB Description: napthalene 1,2-dioxygenase

SCOP Domain Sequences for d1ndob_:

Sequence; same for both SEQRES and ATOM records:

>d1ndob_ d.17.4.4 (B:) Naphthalene 1,2-dioxygenase beta subunit {Pseudomonas putida}
miniqedklvsahdaeeilrffnchdsalqqeattlltqeahlldiqayrawlehcvgse
vqyqvisrelraaserryklneamnvynenfqqlkvrvehqldpqnwgnspklrftrfit
nvqaamdvndkellhirsnvilhrarrgnqvdvfyaaredkwkrgeggvrklvqrfvdyp
erilqthnlmvfl

Timeline for d1ndob_:

• d1ndob_ first appeared (with stable ids) in SCOP 1.55
  
• d1ndob_ appears in SCOP 1.61
  
• d1ndob_ appears in SCOP 1.65
  
• d1ndob_ appears in the current release, SCOPe 2.08