Lineage for d1eg9b_ (1eg9 B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1404616Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1405093Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1405348Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins)
    Pfam PF00866
  6. 1405360Protein Naphthalene 1,2-dioxygenase beta subunit [54439] (4 species)
  7. 1405361Species Pseudomonas putida [TaxId:303] [54440] (10 PDB entries)
  8. 1405363Domain d1eg9b_: 1eg9 B: [38120]
    Other proteins in same PDB: d1eg9a1, d1eg9a2
    complexed with fe, fes, ind, so4

Details for d1eg9b_

PDB Entry: 1eg9 (more details), 1.6 Å

PDB Description: naphthalene 1,2-dioxygenase with indole bound in the active site.
PDB Compounds: (B:) protein (naphthalene 1,2-dioxygenase beta subunit)

SCOPe Domain Sequences for d1eg9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eg9b_ d.17.4.4 (B:) Naphthalene 1,2-dioxygenase beta subunit {Pseudomonas putida [TaxId: 303]}
miniqedklvsahdaeeilrffnchdsalqqeattlltqeahlldiqayrawlehcvgse
vqyqvisrelraaserryklneamnvynenfqqlkvrvehqldpqnwgnspklrftrfit
nvqaamdvndkellhirsnvilhrarrgnqvdvfyaaredkwkrgeggvrklvqrfvdyp
erilqthnlmvfl

SCOPe Domain Coordinates for d1eg9b_:

Click to download the PDB-style file with coordinates for d1eg9b_.
(The format of our PDB-style files is described here.)

Timeline for d1eg9b_: