Lineage for d4tsub_ (4tsu B:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 190011Fold d.17: Cystatin-like [54402] (5 superfamilies)
  4. 190149Superfamily d.17.4: NTF2-like [54427] (4 families) (S)
  5. 190213Family d.17.4.3: Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54434] (1 protein)
  6. 190214Protein Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54435] (2 species)
  7. 190227Species Pseudomonas putida [TaxId:303] [54437] (11 PDB entries)
  8. 190240Domain d4tsub_: 4tsu B: [38119]

Details for d4tsub_

PDB Entry: 4tsu (more details), 2.5 Å

PDB Description: crystal structure of ketosteroid isomerase complexed with inhibitor

SCOP Domain Sequences for d4tsub_:

Sequence, based on SEQRES records: (download)

>d4tsub_ d.17.4.3 (B:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida}
nlptaqevqglmaryielvdvgdieaivqmyaddatvedpfgqppihgreqiaafyrqgl
gggkvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqayws
evnlsv

Sequence, based on observed residues (ATOM records): (download)

>d4tsub_ d.17.4.3 (B:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida}
nlptaqevqglmaryielvdvgdieaivqmyaddatvedpfgqppihgreqiaafyrqgl
kvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqaywsevn
lsv

SCOP Domain Coordinates for d4tsub_:

Click to download the PDB-style file with coordinates for d4tsub_.
(The format of our PDB-style files is described here.)

Timeline for d4tsub_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4tsua_