SCOPe 2.08: Domain d6s9ea2: 6s9e A:246-437

Lineage for d6s9ea2 (6s9e A:246-437)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein automated matches [227071] (7 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226565] (136 PDB entries)

8. Domain d6s9ea2: 6s9e A:246-437 [381100]
   Other proteins in same PDB: d6s9ea1, d6s9eb1, d6s9ec1, d6s9ed1, d6s9ee_, d6s9ef1, d6s9ef2
   automated match to d1tuba2
   complexed with acp, af3, ca, cl, gdp, gol, gtp, imd, mes, mg

Details for d6s9ea2

PDB Entry: 6s9e, 2.25 Å

PDB Description: tubulin-gdp.alf complex

PDB Compounds: (A:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d6s9ea2:

Sequence, based on SEQRES records:

>d6s9ea2 d.79.2.1 (A:246-437) automated matches {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgv

Sequence, based on observed residues (ATOM records):

>d6s9ea2 d.79.2.1 (A:246-437) automated matches {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekheqlsvaeitnacfepanqmvkcdp
rhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpggd
lakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedmaa
lekdyeevgv

Timeline for d6s9ea2:

• d6s9ea2 first appeared in SCOPe 2.07